Web Server Statistics for yarranet.net.au Web Server Statistics for yarranet.net.au(Go To: Top: General Summary: Weekly Report: Daily Report: Daily Summary: Hourly Summary: Domain Report: Organisation Report: Host Report: Redirected Referrer Report: Failed Referrer Report: Referrer Report: Referring Site Report: Search Query Report: Search Word Report: Browser Summary: Operating System Report: Status Code Report: Directory Report: Redirection Report: Failure Report: Request Report)
This report contains overall statistics.
Successful requests: 219,099
Average successful requests per day: 7,068
Successful requests for pages: 90,906
Average successful requests for pages per day: 2,932
Failed requests: 9,732
Redirected requests: 14,463
Distinct files requested: 8,227
Distinct hosts served: 20,232
Corrupt logfile lines: 5
Data transferred: 2.762 gigabytes
Average data transferred per day: 91.262 megabytes
This report lists the activity in each week.
Each unit (
) represents 800 requests
for pages or part thereof.
week beg.: reqs: pages: ---------: -----: -----: 28/Sep/03: 26662: 12403:Busiest week: week beginning 12/Oct/03 (25,644 requests for pages).5/Oct/03: 47503: 19040:
12/Oct/03: 54211: 25644:
26/Oct/03: 44575: 16459:
This report lists the activity in each day.
Each unit () represents 250 requests
for pages or part thereof.
date: reqs: pages: ---------: -----: -----: 30/Sep/03: 1: 1:Busiest day: 15/Oct/03 (8,803 requests for pages).7/Oct/03: 7537: 3272:
This report lists the total activity for each day of the week, summed over all the weeks in the report.
Each unit () represents 500 requests
for pages or part thereof.
day: reqs: pages: ---: -----: -----: Sun: 20665: 10180:
This report lists the total activity for each hour of the day, summed over all the days in the report.
Each unit () represents 200 requests
for pages or part thereof.
hour: reqs: pages: ----: -----: -----: 0: 7665: 3286:
This report lists the countries of the computers which requested files.
Listing domains, sorted by the amount of traffic.
reqs: %bytes: domain
-----: ------: ------
52332: 21.81%: .com (Commercial)
49130: 21.32%: [unresolved numerical addresses]
29610: 15.70%: .net (Networks)
61022: 15.44%: .au (Australia)
279: 6.95%: .sg (Singapore)
1032: 2.95%: .il (Israel)
91: 1.54%: .tz (Tanzania)
1525: 1.46%: .nl (Netherlands)
441: 1.46%: .de (Germany)
2924: 1.24%: .uk (United Kingdom)
475: 1.22%: .pl (Poland)
2733: 1.05%: .ca (Canada)
350: 0.98%: .br (Brazil)
3024: 0.96%: .edu (USA Higher Education)
1172: 0.66%: .fr (France)
223: 0.65%: .ee (Estonia)
1746: 0.40%: .org (Non Profit Making Organisations)
1588: 0.39%: .us (United States)
223: 0.38%: .se (Sweden)
132: 0.36%: .gr (Greece)
232: 0.31%: .es (Spain)
706: 0.28%: .be (Belgium)
1021: 0.28%: .nz (New Zealand)
482: 0.26%: .it (Italy)
691: 0.24%: .jp (Japan)
84: 0.19%: .cz (Czech Republic)
1436: 0.14%: [domain not given]
231: 0.12%: .mx (Mexico)
431: 0.11%: .pt (Portugal)
50: 0.10%: .lt (Lithuania)
408: 0.10%: .ch (Switzerland)
345: 0.08%: .mil (USA Military)
142: 0.06%: .at (Austria)
224: 0.06%: .dk (Denmark)
85: 0.05%: .tw (Taiwan)
159: 0.05%: .fi (Finland)
100: 0.05%: .biz (Businesses)
144: 0.04%: .no (Norway)
111: 0.04%: .ar (Argentina)
214: 0.04%: .id (Indonesia)
172: 0.04%: .gov (USA Government)
161: 0.04%: .hu (Hungary)
134: 0.03%: .ie (Ireland)
125: 0.03%: .za (South Africa)
87: 0.03%: .hr (Croatia)
80: 0.03%: .ph (Philippines)
82: 0.03%: .my (Malaysia)
110: 0.02%: .sa (Saudi Arabia)
59: 0.02%: .in (India)
32: 0.02%: .ro (Romania)
26: 0.02%: .yu (Yugoslavia)
39: 0.02%: .ae (United Arab Emirates)
79: 0.01%: .tr (Turkey)
113: 0.01%: .cy (Cyprus)
18: 0.01%: .ua (Ukraine)
13: 0.01%: .th (Thailand)
45: 0.01%: .arpa (Arpanet)
2: 0.01%: .tg (Togo)
29: 0.01%: .eg (Egypt)
26: 0.01%: .nu (Niue)
34: 0.01%: .hk (Hong Kong)
14: 0.01%: .int (International Treaty Organisations)
7: 0.01%: .cr (Costa Rica)
24: 0.01%: .ru (Russia)
9: 0.01%: .uy (Uruguay)
18: 0.01%: .cl (Chile)
20: : .co (Colombia)
6: : .zw (Zimbabwe)
28: : .mz (Mozambique)
11: : .pk (Pakistan)
11: : .sk (Slovakia)
11: : .ir (Iran)
12: : .mu (Mauritius)
7: : .tt (Trinidad and Tobago)
6: : .bm (Bermuda)
6: : .bw (Botswana)
9: : .gt (Guatemala)
7: : .qa (Qatar)
2: : .bg (Bulgaria)
5: : .mt (Malta)
5: : .pf (French Polynesia)
6: : .sy (Syria)
8: : .bz (Belize)
5: : .is (Iceland)
3: : .kr (South Korea)
5: : .st (Saint Tome and Principe)
4: : .pe (Peru)
2: : .ke (Kenya)
4: : .tv (Tuvalu)
5: : .bs (Bahamas)
2: : .ls (Lesotho)
1: : .lu (Luxembourg)
1: : .tc (Turks and Caicos Islands)
4: : .ba (Bosnia-Herzegovina)
4: : .si (Slovenia)
5: : .lv (Latvia)
1: : .fj (Fiji)
1: : .lb (Lebanon)
2: : .kz (Kazakhstan)
1: : .info (Informational)
1: : .jm (Jamaica)
1: : .md (Moldova)
1: : .ve (Venezuela)
This report lists the organisations of the computers which requested files.
Listing the top 50 organisations by the number of requests for pages, sorted by the number of requests for pages.
reqs: pages: %bytes: organisation ------: -----: ------: ------------ 7784: 6308: 2.56%: inktomisearch.com 6502: 5727: 2.54%: av.com 4793: 4767: 1.34%: 63.174 3358: 3288: 1.02%: teoma.com 4972: 2995: 2.35%: googlebot.com 2531: 2490: 0.79%: looksmart.com 2571: 2471: 0.16%: 210.8 2187: 2095: 0.42%: fastsearch.net 1727: 1715: 0.46%: serveur.com 3790: 1643: 1.71%: aol.com 1943: 1555: 1.51%: rogers.com 7194: 1411: 1.77%: optusnet.com.au 1488: 1282: 0.36%: alexa.com 2716: 1191: 3.51%: rr.com 7802: 1156: 1.85%: bigpond.net.au 1090: 1040: : 203.89 3962: 947: 1.20%: uu.net 4873: 894: 1.16%: tmns.net.au 5854: 887: 1.44%: iprimus.net.au 2418: 869: 0.08%: x-echo.com 816: 816: 0.14%: ctcnsc.org 1436: 689: 1.72%: 12 3473: 663: 1.24%: comindico.com.au 1600: 632: 0.63%: attbi.com 546: 546: 0.12%: bchosting.com 551: 535: 0.43%: astronnet.com.au 1164: 510: 0.26%: optonline.net 506: 496: 0.14%: turnitin.com 1188: 494: 0.37%: comcast.net 1203: 474: 2.66%: cox.net 2036: 414: 0.49%: tpgi.com.au 897: 404: 0.25%: pacbell.net 1007: 404: 0.25%: btopenworld.com 1397: 374: 0.23%: 203.162 415: 371: 0.09%: 207.14 370: 365: 0.01%: 66.150 356: 354: 0.08%: 64.241 691: 340: 0.08%: psci.net 2564: 339: 0.58%: vicnet.net.au 1469: 335: 0.21%: chariot.net.au 745: 319: 0.22%: bellsouth.net 314: 314: 0.22%: 218.37 1436: 308: 0.14%: [domain not given] 611: 300: 0.45%: level3.net 867: 300: 0.08%: 203.17 669: 288: 0.75%: bezeqint.net 2069: 287: 0.49%: netspace.net.au 730: 274: 0.27%: verizon.net 302: 261: 0.43%: a2000.nl 436: 248: 0.40%: microsoft.com 107680: 33721: 60.35%: [not listed: 5,059 organisations]
This report lists the computers which requested files.
Listing the top 50 hosts by the number of requests for pages, sorted alphabetically.
reqs: pages: host ------: -----: ---- 302: 151: 12.148.209.196 493: 245: 12.148.209.198 4793: 4767: 63.174.236.99 352: 352: 64.241.243.66 201: 201: 66.150.40.79 1068: 1038: 203.89.194.98 1291: 322: 203.162.166.61 342: 330: 207.14.224.35 2448: 2430: 210.8.18.17 314: 314: 218.37.120.141 149: 143: 220.73.165.13 249: 242: s100tx-m126.fast-ether.syd01.astronnet.com.au 239: 233: s100tx-m134.fast-ether.syd01.astronnet.com.au 140: 140: news.assertive.ca 231: 212: crawl22-public.alexa.com 338: 308: crawl23-public.alexa.com 335: 305: crawl24-public.alexa.com 336: 309: crawl25-public.alexa.com 333: 198: bigip1a-snat.sv.av.com 375: 369: bsd-perf1.sv.av.com 1646: 1637: buildrack53.sv.av.com 276: 158: drone10.sv.av.com 221: 158: drone11.sv.av.com 2643: 2589: trek22.sv.av.com 496: 496: 66-154-97-27.bchosting.com 220: 215: www.entireweb.com 689: 647: crawler10.googlebot.com 651: 618: crawler11.googlebot.com 362: 341: crawler13.googlebot.com 767: 719: crawler14.googlebot.com 238: 228: crawler15.googlebot.com 1828: 1798: crawlers.looksmart.com 694: 683: sv-fw.looksmart.com 898: 898: cpe000502cb5313-cm014280007075.cpe.net.cable.rogers.com 495: 494: cpe0080c6fdb519-cm014410125793.cpe.net.cable.rogers.com 163: 159: cpe-66-27-226-232.bak.rr.com 1727: 1715: serveur.com 321: 307: egspd400.teoma.com 276: 267: egspd409.teoma.com 2755: 2713: egspd443.teoma.com 474: 465: cr3.turnitin.com 809: 290: x1crawler1-1-0.x-echo.com 862: 319: x1crawler2-1-0.x-echo.com 747: 260: x1crawler3-1-0.x-echo.com 509: 501: cr015r01-3.sac2.fastsearch.net 1252: 1247: fixcr002.sac2.fastsearch.net 291: 281: mmscrm03-1.sac2.fastsearch.net 177: 177: pm66.internetseer.net 816: 816: rampart.ctcnsc.org 1223: 221: webdesign 180244: 56880: [not listed: 20,182 hosts]
This report lists the referrers that caused redirected requests.
Listing the top 30 referring URLs by the number of redirected requests, sorted by the number of redirected requests.
reqs: URL ----: --- 2175: http://www.yarranet.net.au/OnThisDay/otd.htm 752: http://www.yarranet.net.au/onthisday/ 536: http://members.tripod.com/~PhyllisJoy/thisday.html 116: http://www.acenetfln.net/ 108: http://www.yarranet.net.au/onthisday/1028.htm 106: http://www.yarranet.net.au/OnThisDay/0803.HTM 105: http://www.yarranet.net.au/yarranet/stats/2003/02/2003_02_yarranet_report.html 97: http://www.yarranet.net.au/onthisday/1029.htm 94: http://www.yarranet.net.au/domainbakery/ 83: http://www.yarranet.net.au/ 78: http://www.yarranet.net.au/onthisday/1016.htm 70: http://search.ninemsn.com.au/results.aspx 66: http://www.yarranet.net.au/onthisday/1001.htm 62: http://www.yarranet.net.au/onthisday/1023.htm 60: http://www.yarranet.net.au/onthisday/1015.htm 60: http://www.yarranet.net.au/onthisday/1024.htm 57: http://www.yarranet.net.au/onthisday/1030.htm 57: http://www.yarranet.net.au/onthisday/1008.htm 56: http://yarranet.net.au/onthisday/ 55: http://www.yarranet.net.au/onthisday/1014.htm 55: http://www.yarranet.net.au/onthisday/0101.htm 55: http://www.yarranet.net.au/onthisday/1017.htm 54: http://www.yarranet.net.au/onthisday/1007.htm 54: http://www.yarranet.net.au/onthisday/1020.htm 50: http://www.yarranet.net.au/onthisday/1009.htm 50: http://www.yarranet.net.au/onthisday/1027.htm 48: http://www.yarranet.net.au/onthisday/1006.htm 47: http://www.yarranet.net.au/onthisday/1010.htm 46: http://www.yarranet.net.au/onthisday/1025.htm 46: http://www.yarranet.net.au/onthisday/1031.htm 3988: [not listed: 640 URLs]
This report lists the referrers containing broken links to the site.
Listing the top 30 referring URLs by the number of failed requests, sorted by the number of failed requests.
reqs: URL ----: --- 2784: http://www.yarranet.net.au/aceweb/econf/2003/schedule.htm 435: http://images.google.com/imgres 17: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/d-beauty-v.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary23-8.htm&h=173&w=292&prev=/images%3Fq%3Dbeauty%26start%3D80%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8%26sa%3DN&frame=small 14: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/d-beauty-v.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary23-8.htm&h=173&w=292&prev=/images%3Fq%3Dbeauty%26start%3D80%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8%26sa%3DN 12: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/d-kate-b-s.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary23-8.htm&h=320&w=250&prev=/images%3Fq%3Dgraffiti+words%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8&frame=small 11: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/atm.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary23-8.htm&h=240&w=195&prev=/images%3Fq%3Datm%26start%3D40%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8%26sa%3DN&frame=small 10: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/d-circus-s.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary.htm&h=271&w=200&prev=/images%3Fq%3Dcircus%26start%3D380%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8%26sa%3DN&frame=small 10: http://images.google.com/imgres?imgurl=www.yarranet.net.au/womar/d-kate-b-s.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary23-8.htm&h=320&w=250&prev=/images%3Fq%3Dgraffiti+cartoons%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8&frame=small 102: http://www.yarranet.net.au/cwmacfe/ 98: http://www.yarranet.net.au/webwords 83: http://www.yarranet.net.au/yarranet/hosted.html 80: http://images.google.ca/imgres 11: http://images.google.ca/imgres?imgurl=www.yarranet.net.au/womar/d-act-glass-black.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary.htm&h=290&w=262&prev=/images%3Fq%3Dglass%26start%3D200%26svnum%3D10%26hl%3Den%26lr%3D%26ie%3DUTF-8%26sa%3DN&frame=small 79: http://yarranet.net.au/webwords 76: http://images.google.com.au/imgres 67: http://www.yarranet.net.au/yarranet/training.html 54: http://www.yarranet.net.au/yarranet/stats/2003/02/2003_02_yarranet_report.html 39: http://images.search.yahoo.com/search/images/view 39: http://216.239.39.104/search 39: http://216.239.39.104/search?q=cache:z15IDw93QNwJ:www.yarranet.net.au/e-learning/+what+is+a+learning+community&hl=en&ie=UTF-8 39: http://www.google.com.au/search 37: http://images.google.co.uk/imgres 34: http://yarranet.net.au/yarranet/hosted.html 31: http://www.yarranet.net.au/shell/onthisday/onthisday.cgi 25: http://www.yarranet.net.au/shell/onthisday/onthisday.cgi?submit=today 30: http://www.yarranet.net.au/HG/vichg.htm 29: http://www.yarranet.net.au/ccac 29: http://images.google.fr/imgres 15: http://images.google.fr/imgres?imgurl=www.yarranet.net.au/womar/d-cul-de-s.jpg&imgrefurl=http://www.yarranet.net.au/womar/diary.htm&h=289&w=205&prev=/images%3Fq%3Dcul%26svnum%3D10%26hl%3Dfr%26lr%3D%26ie%3DUTF-8%26oe%3DUTF-8&frame=small 28: http://yarranet.net.au/yarranet/training.html 26: http://www.yarranet.net.au/yarranet/tools_webstats.html 24: http://www.yarranet.net.au/OnThisDay/otd.htm 23: http://www.yarranet.net.au/acacia/csrdo/banyulcs.htm 22: http://home.vicnet.net.au/~nell/denis/ 20: http://yarranet.net.au/cedric/balleast/sportlife/cricket/AUS.html 20: http://www.google.ca/search 19: http://www.google.ca/search?q=cache:APkEZu2AnXgJ:www.yarranet.net.au/e-learning/tutor.htm+learning+badminton+online&hl=en&ie=UTF-8 17: http://www.yarranet.net.au/yarranet/stats/2002/09/2002_09_yarranet_report.html 17: http://www.yarracity.vic.gov.au/children/primaryschools.asp 17: http://images.google.de/imgres 17: http://www.yarranet.net.au/HG/hgfa.htm 785: [not listed: 235 URLs]
This report lists the referrers (where people followed links from, or pages which included this site's images).
Listing the top 50 referring URLs by the number of requests for pages, sorted by the number of requests for pages.
no.: reqs: pages: URL ---: ------: -----: --- 1: 3671: 3671: http://www.yarranet.net.au/yarranet/stats/2003/02/2003_02_yarranet_report.html 2: 3452: 3332: http://www.google.com.au/search 3: 3116: 3084: http://www.google.com/search 4: 2297: 2297: http://217.154.97.2/dob/more.asp 5: 6165: 2128: http://www.yarranet.net.au/OnThisDay/otd.htm 6: 1432: 1422: http://search.yahoo.com/search 7: 1091: 604: http://www.yarranet.net.au/onthisday/ 8: 579: 574: http://au.search.yahoo.com/search/aunz 9: 3908: 503: http://www.yarranet.net.au/aceweb/econf/2003/ 10: 453: 453: http://search.msn.com/results.asp : 263: 263: http://search.msn.com/results.asp?RS=CHECKED&FORM=MSNH&v=1&q=on+this+day 11: 452: 452: http://www.yarranet.net.au/yarranet/stats/2003/03/2003_03_yarranet_report.html 12: 1571: 434: http://www.yarranet.net.au/ 13: 434: 432: http://search.ninemsn.com.au/results.aspx 14: 405: 405: http://members.tripod.com/~PhyllisJoy/thisday.html 15: 380: 380: http://search.msn.com/results.aspx 16: 347: 337: http://www.google.ca/search 17: 608: 316: http://images.google.com/imgres 18: 299: 299: http://web.ask.com/redir 19: 2028: 257: http://www.yarranet.net.au/aceweb/econf/2003/index.htm 20: 272: 255: http://www.google.co.uk/search 21: 238: 238: http://www.yarranet.net.au/acacia/resource/culture.htm 22: 241: 237: http://search.ninemsn.com.au/spresults.aspx 23: 1224: 230: http://www.yarranet.net.au/aceweb/econf/2003/schedule.htm 24: 759: 222: http://www.yarranet.net.au/womar/womar1.htm 25: 206: 205: http://www.yarranet.net.au/yarranet/stats/2003/07/2003_07_yarranet_report.html 26: 200: 200: http://www.yarranet.net.au/shell/onthisday/onthisday.cgi 27: 190: 188: http://aolsearch.aol.com/aol/search 28: 172: 172: http://www.yarranet.net.au/acacia/resource/vietfam.htm 29: 169: 169: http://www.yarranet.net.au/acacia/resource/rearing.htm 30: 708: 157: http://yarranet.net.au/womar/womar1.htm 31: 142: 142: http://www.yarranet.net.au/acacia/resource/religion.htm 32: 142: 139: http://au.search.anzwers.yahoo.com/search/anzwers 33: 471: 121: http://yarranet.net.au/ 34: 118: 118: http://www.rollanet.org/~sskelton/birthday.html 35: 117: 117: http://search.msn.com/spresults.aspx 36: 117: 117: http://au.altavista.com/web/results 37: 226: 113: http://www.yarranet.net.au/onthisday/1028.htm 38: 112: 111: http://search.ninemsn.com.au/results.asp 39: 109: 109: http://users.netconnect.com.au/~erinmick/done.htm 40: 1057: 107: http://www.yarranet.net.au/womar/previousstars.htm 41: 310: 103: http://www.yarranet.net.au/OnThisDay/0803.HTM 42: 195: 97: http://www.yarranet.net.au/onthisday/1029.htm 43: 168: 85: http://www.yarranet.net.au/aceweb/econf/2003/presenters.htm 44: 83: 83: http://www.yarranet.net.au/acacia/acacia.htm 45: 234: 77: http://www.yarranet.net.au/onthisday/1016.htm 46: 75: 75: http://babyparenting.about.com/gi/dynamic/offsite.htm 47: 75: 75: http://www.yarranet.net.au/acacia/resource/refer.htm 48: 74: 74: http://www.altavista.com/web/results 49: 79: 74: http://www.google.de/search 50: 72: 72: http://www.webwombat.com.au/aus : 106278: 13568: [not listed: 3,416 URLs]
This report lists which servers people followed links from.
Listing referring sites, sorted by the number of requests for pages.
reqs: pages: site
------: -----: ----
115837: 18389: http://www.yarranet.net.au/
3488: 3366: http://www.google.com.au/
3213: 3175: http://www.google.com/
2297: 2297: http://217.154.97.2/
1473: 1463: http://search.yahoo.com/
1035: 1035: http://search.msn.com/
8822: 921: http://yarranet.net.au/
802: 795: http://search.ninemsn.com.au/
603: 595: http://au.search.yahoo.com/
421: 421: http://members.tripod.com/
355: 345: http://www.google.ca/
611: 319: http://images.google.com/
309: 309: http://web.ask.com/
272: 255: http://www.google.co.uk/
201: 198: http://aolsearch.aol.com/
142: 139: http://au.search.anzwers.yahoo.com/
128: 127: http://www.altavista.com/
121: 121: http://au.altavista.com/
118: 118: http://www.rollanet.org/
114: 114: http://www.csu.edu.au/
109: 109: http://users.netconnect.com.au/
77: 77: http://search.netscape.com/
75: 75: http://babyparenting.about.com/
81: 75: http://www.google.de/
72: 72: http://www.webwombat.com.au/
69: 69: http://www.symphonicsoftware.com/
68: 68: http://uk.search.yahoo.com/
68: 67: http://www.dogpile.com/
64: 64: http://home.vicnet.net.au/
60: 60: http://www.google.co.nz/
116: 59: http://images.google.es/
71: 58: http://www.google.co.in/
57: 57: http://library.trinity.wa.edu.au/
56: 55: http://www.ask.co.uk/
54: 54: http://directory.google.com/
102: 50: http://images.google.pt/
53: 50: http://www.google.fr/
48: 48: http://dir.yahoo.com/
47: 46: http://www.google.it/
45: 45: http://www.tafefrontiers.com.au/
53: 43: http://www.google.nl/
41: 41: http://www.cerritos.edu/
40: 40: http://www.google.com.vn/
40: 40: http://www.bace.nsw.gov.au/
42: 39: http://drs.yahoo.com/
71: 38: http://images.search.yahoo.com/
66: 38: http://images.google.ca/
36: 36: http://www.dayspa.com.au/
35: 35: http://www.google.ie/
34: 34: http://www.santarosa.edu/
34: 34: http://www.smes.org/
32: 32: http://www.australiajapan.com/
31: 31: http://searchassistant.looksmart.com.au/
40: 30: http://images.google.fr/
30: 30: http://www.edna.edu.au/
29: 29: http://www.cisnet.com/
58: 29: http://images.google.com.au/
28: 28: http://www.anta.gov.au/
27: 27: http://www.mywebsearch.com/
27: 27: http://www.panix.com/
58: 27: http://images.google.nl/
27: 27: http://kd.mysearch.myway.com/
27: 27: http://www.metacrawler.com/
30: 27: http://www.google.es/
26: 26: http://ca.search.yahoo.com/
25: 25: http://banner.date.com/
25: 25: http://www.xrande.cz/
54: 25: http://images.google.co.uk/
25: 25: http://source.tafevc.com.au/
38: 24: http://www.alltheweb.com/
26: 24: http://tm.wc.ask.com/
24: 24: http://www.onthedayyouwereborn.com/
23: 23: http://online.mq.edu.au/
23: 23: http://www.shortcourses.vic.gov.au/
23: 23: http://aolsearch.aol.co.uk/
23: 23: http://www.google.com.sg/
23: 23: http://www.comcast.net/
22: 22: http://www.travelxl.com/
23: 22: http://www.google.be/
22: 22: http://www.eduweb.vic.gov.au/
22: 21: http://www.google.se/
21: 21: http://www.yarracity.vic.gov.au/
20: 20: http://www.search.com/
20: 20: http://www1.tafevc.com.au/
20: 20: http://www.library.unisa.edu.au/
20: 20: http://www.google.com.my/
19: 19: http://search.freeserve.com/
19: 19: http://www.google.pl/
19: 19: http://www.bvha.org/
20: 18: http://www.google.co.jp/
35: 18: http://images.google.be/
18: 18: http://search.aol.com/
17: 17: http://search.earthlink.net/
17: 17: http://www.google.com.br/
16: 16: http://www.ala.asn.au/
16: 16: http://www.google.com.tr/
15: 15: http://www.beeraustralia.com/
15: 15: http://www.alltomhundar.com/
15: 15: http://www.google.pt/
15: 15: http://www.curriculum.edu.au/
15: 15: http://websearch.optusnet.com.au/
14: 14: http://www.clik.to/
14: 14: http://www.search123.com/
14: 14: http://msxml.excite.com/
13: 13: http://www.google.co.il/
13: 13: http://www.refugeecouncil.org.au/
13: 13: http://www.geocities.com/
13: 13: http://dpxml.webcrawler.com/
13: 13: http://search.aol.com.au/
13: 13: http://anulib.anu.edu.au/
13: 13: http://www.quia.com/
17: 13: http://www.google.com.mx/
13: 13: http://www.google.fi/
12: 12: http://mysearch.myway.com/
12: 12: http://www.arhs.net/
12: 12: http://www.inn26.com/
12: 12: http://is1.websearch.com/
12: 12: http://www.vicnet.net.au/
21: 12: http://images.google.com.br/
11: 11: http://dir.nodeworks.com/
11: 11: http://www.cs.oswego.edu/
11: 11: http://www.acevic.org.au/
11: 11: http://www.visitvictoria.com/
11: 11: http://ms101.mysearch.com/
11: 11: http://search.cometsystems.com/
11: 11: http://www.google.dk/
11: 11: http://www.daylesford.net.au/
11: 11: http://search.iwon.com/
16: 11: http://www.google.com.tw/
10: 10: http://www.abc.net.au/
10: 10: http://www.education.vic.gov.au/
10: 10: http://lpil.jokie.net/
10: 10: http://www.richsun.com/
10: 10: http://searchresults.news.com.au/
10: 10: http://www.mamnon.org/
10: 10: http://translate.google.com/
11: 10: http://www.google.ch/
9: 9: http://encarta.msn.com/
9: 9: http://webferret.search.com/
9: 9: http://www.auscharity.org/
9: 9: http://www.usa-wins.com/
9: 9: http://www.communities.org.uk/
9: 9: http://www.iaea.org/
9: 9: http://s1.search66.com/
12: 9: http://www.google.com.hk/
11: 9: http://pictures.ask.com/
9: 9: http://www.google.at/
9: 9: http://www.google.com.pk/
12: 9: http://www.google.cl/
9: 9: http://www.womenaustralia.info/
9: 9: http://pesquisa.sapo.pt/
8: 8: http://uk.search.msn.com/
8: 8: http://go.google.com/
8: 8: http://search.naver.com/
8: 8: http://libwww.cabrillo.edu/
12: 8: http://www.google.com.gr/
23: 8: http://learnscope.flexiblelearning.net.au/
8: 8: http://home.iprimus.com.au/
13: 8: http://images.google.pl/
8: 8: http://dmoz.org/
8: 8: http://www.lilesnet.com/
8: 8: http://www.mcnhs.org/
7: 7: http://www.google.lt/
131: 7: http://www.acacia-centre.org.au/
13: 7: http://images.google.ch/
7: 7: http://search.lycos.com/
7: 7: http://www.iraqipapers.com/
12: 7: http://www.google.com.ar/
8: 7: http://www.google.co.th/
7: 7: http://webmail.holmesglen.vic.edu.au/
7: 7: http://www.maytel.net.au/
7: 7: http://scis.curriculum.edu.au/
7: 7: http://www.visitvictoria.com.au/
7: 7: http://65.54.244.250/
7: 7: http://www.aris.com.au/
8: 7: http://www.eniro.se/
7: 7: http://www.alphalink.com.au/
7: 7: http://ww.google.com/
6: 6: http://www.distinguishedwomen.com/
6: 6: http://www.google.co.kr/
6: 6: http://an.on.bell.ca/
6: 6: http://www.classicamerican.com.au/
6: 6: http://www.vietbc.com/
6: 6: http://uk.altavista.com/
29: 6: http://www.learnscope.anta.gov.au/
6: 6: http://www.cultureandrecreation.gov.au/
6: 6: http://ixquick.com/
6: 6: http://altavista.com/
6: 6: http://www.ringsurf.com/
6: 6: http://www.searchalot.com/
6: 6: http://www.gocee.com/
6: 6: http://www.busywomen.com.au/
5: 5: http://www.artnews.com.au/
5: 5: http://www.hotbot.com/
5: 5: http://www.familyhistorysa.info/
5: 5: http://commdir.profix.com.au/
5: 5: http://www.feminist.com/
225: 5: http://216.239.57.104/
5: 5: http://www.urbin.net/
68: 5: http://www.tafevc.com.au/
5: 5: http://172.16.0.47:15871/
5: 5: http://www.moniteau.k12.pa.us/
5: 5: http://www.nembc.org.au/
8: 5: http://images.google.dk/
7: 5: field blocked by outpost (http://www.agnitum.com)/
6: 5: http://websearch.cnn.com/
5: 5: http://www2.google.com/
7: 5: http://www.google.com.co/
5: 5: http://www.beautifulaccommodation.com/
5: 5: http://shortcourses.vic.gov.au/
5: 5: http://groups.google.com/
5: 5: http://search.ke.voila.fr/
5: 5: http://www.iisg.nl/
5: 5: http://commserver/
5: 5: http://64.4.8.250/
5: 5: http://www.brownbagfibers.com/
5: 5: http://web.ukonline.co.uk/
5: 5: http://www.fudgerpg.com/
5: 5: http://www.aaart.tv/
75: 5: http://216.239.37.104/
12: 5: http://images.google.se/
5: 5: http://www.karljones.com/
5: 5: http://www.google.com.pe/
177: 5: http://203.17.69.65/
5: 5: http://home.planet.nl/
5: 5: http://www.artistsfootsteps.com/
5: 5: http://www.rootsweb.com/
5: 5: http://www.academiccolab.org/
5: 5: http://www.partyguideonline.com/
5: 4: http://images.google.com.hk/
4: 4: http://members.optushome.com.au/
4: 4: http://users.senet.com.au/
4: 4: http://dir.lycos.com/
4: 4: http://aolsearch.aol.com.au/
4: 4: http://www.utas.edu.au/
4: 4: http://homepage.powerup.com.au/
4: 4: http://www.dlcoursefinder.com/
4: 4: http://www.gateway.net.au/
9: 4: http://images.google.com.mx/
10: 4: http://images.google.de/
4: 4: http://www.litlearning.com/
4: 4: http://www3.tafevc.com.au/
4: 4: http://www.embark.to/
4: 4: http://www.findtarget.com/
4: 4: http://uk.dir.yahoo.com/
4: 4: http://es.altavista.com/
4: 4: http://explore.goeureka.com.au/
4: 4: http://search.sli.sympatico.ca/
4: 4: http://directory.teradex.com/
4: 4: http://www.alexa.com/
4: 4: http://www.acay.com.au/
4: 4: http://websearch.cs.com/
4: 4: http://www.arts.monash.edu.au/
4: 4: http://forums.mozillazine.org/
4: 4: http://uk.srd.yahoo.com/
4: 4: http://auto.search.msn.com/
4: 4: http://visitvictoria.com/
4: 4: http://www.google/
4: 4: http://bloxword.ca/
4: 4: http://mymail.telstra.com/
4: 4: http://webmail.kangan.edu.au/
5: 4: http://www.google.co.hu/
4: 4: http://www.springfield.k12.il.us/
4: 4: http://visitvictoria.com.au/
3: 3: http://www.mamma.com/
3: 3: http://search.startium.com/
3: 3: http://www.linkers.co.uk/
3: 3: http://www.art-almanac.com.au/
3: 3: http://apple.directhit.com/
3: 3: http://www.aviva.org/
5: 3: http://br.cade.busca.yahoo.com/
3: 3: http://w1.462.comhem.se/
3: 3: http://www.travelhops.com/
3: 3: http://sitefinder.verisign.com/
7: 3: http://images.google.ae/
3: 3: http://www.download-games-and-free-game-downloads.com/
6: 3: http://images.google.az/
3: 3: http://aolsearch.aol.ca/
3: 3: http://www.acfe.vic.gov.au/
3: 3: http://www.member.tripod.com/
3: 3: http://search.virgilio.it/
3: 3: http://www.labyrinth.net.au/
3: 3: http://www.dimotiko.gr/
5: 3: http://images.google.cl/
3: 3: http://www.radioearth.com/
3: 3: http://www.anhlc.asn.au/
3: 3: http://clickit.go2net.com/
3: 3: http://search3.vivisimo.com/
3: 3: http://www.buzzle.com/
3: 3: http://www.looksmart.com/
3: 3: http://websearch.broadband.optusnet.com.au/
3: 3: http://www.alseye.com/
3: 3: http://ca.search.msn.com/
3: 3: http://www.aolimages.aol.fr/
5: 3: http://images.google.fi/
3: 3: http://www.random.org/
3: 3: http://www.eldtrain.com.au/
3: 3: http://www.community.gov.au/
3: 3: http://www.excite.co.uk/
3: 3: http://www.kasbah.com/
3: 3: http://anhlc.asn.au/
3: 3: http://search.education.vic.gov.au/
3: 3: http://au.dir.yahoo.com/
4: 3: http://images.google.com.tr/
6: 3: http://images.google.com.tw/
3: 3: http://mail.chisholm.vic.edu.au/
3: 3: http://www.acfecwm.vic.edu.au/
3: 3: http://www.training.sa.gov.au/
7: 3: http://pub17.bravenet.com/
3: 3: http://www.mymail.com.au/
3: 3: http://search.xtramsn.co.nz/
3: 3: http://sln.fi.edu/
3: 3: http://www.sci.usq.edu.au/
3: 3: http://sidesearch.lycos.com/
3: 3: http://find.web.aol.com/
3: 3: http://avoca.vicnet.net.au/
3: 3: http://members.aol.com/
3: 3: http://www.links.infoxchange.net.au/
3: 3: http://www.ballaratgenealogy.org.au/
3: 3: http://aitch.cs.oswego.edu:6789/
3: 3: http://www.ezgov.com.au/
3: 3: http://www.google.ae/
3: 3: http://www001.upp.so-net.ne.jp/
3: 3: http://www.google.com.pr/
3: 3: http://216.239.37.99/
3: 3: http://64.4.10.250/
3: 3: http://www.newbedford.k12.ma.us/
3: 3: http://ms106.mysearch.com/
5: 3: http://www.globaled.com/
7: 3: http://images.google.com.co/
3: 3: http://iteslj.org/
3: 3: http://ww.google.com.au/
3: 3: http://users.tebenet.nl/
3: 3: http://www.theglassceiling.com/
3: 3: http://members.ozemail.com.au/
3: 3: http://aitch.cs.oswego.edu/
2: 2: http://www.sjv.woll.catholic.edu.au/
4: 2: http://images.google.co.jp/
2: 2: http://home.eircom.net/
2: 2: http://webmail.ames.vic.edu.au/
2: 2: http://www.denistoneeast.nsw.edu.au/
2: 2: http://192.168.233.12:15871/
2: 2: http://www.cyclingforums.com/
2: 2: http://activeurls.com/
2: 2: http://exchange.batchelor.edu.au/
2: 2: http://search5.vivisimo.com/
2: 2: http://www.members.optushome.com.au/
2: 2: http://pt.altavista.com/
2: 2: xxxx:++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
2: 2: http://us.f207.mail.yahoo.com/
14: 2: http://mc2.vicnet.net.au/
2: 2: http://www.crayon.net/
3: 2: http://www.google.lv/
2: 2: http://www2.fhs.usyd.edu.au/
2: 2: xxxx:++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
2: 2: http://search.msn.co.za/
2: 2: http://www.zeroland.co.nz/
2: 2: http://www.killerinfo.com/
37: 2: http://www.ymrl.org.au/
2: 2: http://snow.utoronto.ca/
2: 2: http://www.mysearch.com/
2: 2: http://64.4.22.250/
2: 2: http://www.acys.utas.edu.au/
2: 2: http://search.msn.com.hk/
2: 2: http://216.239.51.100/
2: 2: http://www.re-quest.net/
25: 2: http://216.239.59.104/
2: 2: http://www.andornot.com/
2: 2: http://www.education.gov.au/
2: 2: http://dk.search.yahoo.com/
2: 2: http://groups.google.co.uk/
2: 2: http://www.kwmap.com/
2: 2: http://www.looksmart.com.au/
2: 2: http://64.4.14.250/
2: 2: http://staff.norman.k12.ok.us/
3: 2: http://images.google.co.th/
2: 2: http://broward.eduprise.com/
2: 2: http://thelocaltourist.com.au/
2: 2: http://www.health.vic.gov.au/
2: 2: http://inet.realadventure.co.uk/
2: 2: http://zoek.vinden.nl/
2: 2: http://www.google.co.ve/
2: 2: http://search.kvasir.no/
2: 2: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
2: 2: http://www.fi.edu/
2: 2: http://webdirectory.optusnet.com.au/
2: 2: http://seenet2/
2: 2: http://www.travelersdigest.com/
2: 2: http://phyllisjoy.tripod.com/
2: 2: http://iprimus.looksmart.com.au/
2: 2: http://college.library.wisc.edu/
2: 2: http://www.ssn.flinders.edu.au/
2: 2: http://www.zuvio.com/
2: 2: http://s.teoma.com/
4: 2: http://images.google.com.uy/
2: 2: http://www-rcf.usc.edu/
2: 2: http://www.multiculturalaustralia.com.au/
2: 2: http://google.com/
2: 2: http://www.answerbus.com/
2: 2: http://www.savaea.org.au/
2: 2: http://raemec.com.au/
2: 2: http://ki.mysearch.myway.com/
2: 2: http://www.home.aone.net.au/
2: 2: http://search.sympatico.ca/
2: 2: http://sg.search.yahoo.com/
2: 2: http://www.cannylink.com/
2: 2: http://prace.vic.edu.au/
2: 2: http://www.acn.net.au/
3: 2: http://animalfocus.com/
2: 2: http://webresources.freeservers.com/
2: 2: http://www.ditto.com/
2: 2: http://ms108.mysearch.com/
2: 2: http://www.stars-in-sky.com/
2: 2: http://search.msn.co.kr/
2: 2: http://www.webceo.com/
2: 2: http://intranet.egtafe.vic.edu.au/
2: 2: http://www.ub.uni-duesseldorf.de/
2: 2: http://labs1.google.com/
2: 2: http://deep-depth-miner.com/
2: 2: http://www.bluep.com/
2: 2: http://www.newhall.cam.ac.uk/
2: 2: http://search.about.com/
2: 2: http://wwar.com/
2: 2: http://g.msn.com/
2: 2: http://www1.giantexplorer.com/
2: 2: http://szukaj.wp.pl/
2: 2: http://fudge.phoenyx.net/
2: 2: http://www.bellsouth.net/
2: 2: http://www.wisenut.com/
2: 2: http://65.54.246.250/
2: 2: http://search2.vivisimo.com/
2: 2: http://de.altavista.com/
2: 2: http://indiatimes-search.altavista.com/
2: 2: http://www.google.com.ru/
2: 2: http://www.phoenyx.net/
2: 2: http://bailiwick.lib.uiowa.edu/
2: 2: http://webboard.tafensw.edu.au/
2: 2: http://www.infoairports.com/
3: 2: http://www.ubbi.com/
2: 2: http://asia.google.yahoo.com/
2: 2: http://google.com.au/
2: 2: http://www.angelfire.com/
2: 2: http://www.tapuz.co.il/
2: 2: http://www.mytelus.com/
29: 2: http://216.239.39.104/
4: 2: http://images.google.co.in/
1: 1: http://mlm1.multimediahouse.us/
1: 1: http://soeg.jubii.dk/
1: 1: http://www.acfebsw.vic.edu.au/
1: 1: http://www.castlegk.com/
1: 1: http://www.surfwax.com/
1: 1: http://corolla70.webcrossing.com/
1: 1: http://home.att.net/
1: 1: http://www.oceanviewths.sa.edu.au/
1: 1: http://198.85.236.25/
1: 1: http://www.englishschoolsfoundation.edu.hk/
1: 1: http://www.overture.com/
1: 1: http://www.optusnet.com.au/
1: 1: http://207.68.176.190/
1: 1: http://www.loboo.se/
2: 1: http://images.google.com.gr/
1: 1: http://courses.unt.edu/
1: 1: http://feien003/
1: 1: http://studentweb.usq.edu.au/
1: 1: http://us.f108.mail.yahoo.com/
1: 1: http://www.coe.ecu.edu/
1: 1: http://www.ecuador.com/
1: 1: http://www.cowwarr.com/
1: 1: http://hionlinedev.tafensw.edu.au/
1: 1: http://www.civ.org.au/
3: 1: http://nifty.amikai.com/
1: 1: http://prace.vic.edu.au:2082/
1: 1: http://www.shambles.net/
1: 1: http://no.search.yahoo.com/
1: 1: http://216.239.57.99/
1: 1: http://dogpile.directhit.com/
1: 1: http://hem.passagen.se/
1: 1: http://search.msn.com.br/
1: 1: http://rootsweb.com/
1: 1: http://www.westcoast.wa.edu.au/
1: 1: http://werple.net.au/
1: 1: http://webmail.westnet.com.au/
2: 1: http://br.busca.yahoo.com/
1: 1: http://www.nla.gov.au/
1: 1: http://www.gogle.it/
1: 1: http://s16.ixquick.com/
1: 1: http://www.anywho.com/
1: 1: http://www.oultwood.com/
1: 1: http://honyakuinfoseek.infoseek.co.jp/
1: 1: http://istos.com.au/
1: 1: http://www.google.kz/
1: 1: http://www.dogtown.co.uk/
1: 1: http://192.168.1.2:15871/
1: 1: http://www.staff.vu.edu.au/
1: 1: http://www.math.okstate.edu/
1: 1: http://www.cws.auz.net/
1: 1: http://wind.prohosting.com/
1: 1: http://www.natsiew.nexus.edu.au/
1: 1: http://203.24.48.79/
1: 1: http://www.thelocaltourist.com.au/
1: 1: http://www.boggabri-p.schools.nsw.edu.au/
1: 1: http://mywebct.tafe.wa.gov.au/
1: 1: http://clk.about.com/
1: 1: http://au.f148.mail.yahoo.com/
2: 1: http://images.google.co.nz/
1: 1: http://147.109.212.40/
1: 1: http://www.google.mu/
1: 1: http://www.training.com.au/
2: 1: http://images.google.at/
1: 1: http://www.msnsearch.com/
1: 1: http://www.lib.monash.edu.au/
1: 1: http://home.hccnet.nl/
1: 1: http://ps5.profusion.com/
1: 1: http://www.kiwe.net/
1: 1: http://217.158.66.28/
1: 1: http://www.epcc.edu/
1: 1: http://in.google.yahoo.com/
1: 1: http://www.wavearts.netfirms.com/
1: 1: http://www.washingtonpost.com/
1: 1: http://jennycarrington.tripod.com/
1: 1: http://www.queryserver.com/
1: 1: http://s11.ixquick.com/
1: 1: http://beeraustralia.com/
1: 1: http://symphonicsoftware.com/
1: 1: http://www.netflames-rpg-bunker.us/
1: 1: http://random.yahoo.com/
1: 1: http://www.mdaa.org.au/
1: 1: http://www.users.bigpond.com/
1: 1: http://ms102.mysearch.com/
3: 1: http://www.historychannel.com/
1: 1: http://www.princetonol.com/
1: 1: http://www.att.net/
1: 1: http://www.pangea.org/
1: 1: http://intranet.rtv.nos.nl/
1: 1: http://www.kniff.de/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://www.dmoz.org/
1: 1: http://mamma8.mamma.com/
1: 1: http://webmail.dodo.com.au/
1: 1: http://www.mailman.satlink.com.au/
1: 1: http://websearch.edition.cnn.com/
1: 1: http://www.visibility-gap.com/
1: 1: http://ms107.mysearch.com/
1: 1: http://be-fr.altavista.com/
1: 1: http://webmail.spamcop.net/
1: 1: http://odn.excite.co.jp/
1: 1: http://www.southafrica.com/
1: 1: http://us.f100.mail.yahoo.com/
1: 1: http://www.middleharb-p.schools.nsw.edu.au/
1: 1: http://us.f140.mail.yahoo.com/
1: 1: http://www.giantexplorer.com/
1: 1: http://utazas.com/
1: 1: http://10.111.14..6/
1: 1: http://users.breathe.com/
1: 1: http://www.szukacz.pl/
1: 1: http://acid.green.net.au/
1: 1: http://hispeed.rogers.com/
1: 1: http://homepage.mac.com/
1: 1: http://www.cbu.edu/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://www.buyasundial.com/
1: 1: http://www.biography.com/
1: 1: http://buscar.uol.com.ar/
1: 1: http://www.vcaa.vic.edu.au/
1: 1: http://ssielearning.tafensw.edu.au/
1: 1: xxxx:++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://search1-1.free.fr/
1: 1: http://www.istarthere.com/
1: 1: http://aolsearcht.aol.com/
1: 1: http://homepages.picknowl.com.au/
1: 1: http://kax.hd.se/
1: 1: http://www.deep-depth-miner.com/
1: 1: http://www.readysetstamp.com.au/
1: 1: http://www.jordanpaperarts.com/
1: 1: http://www2.giantexplorer.com/
82: 1: http://www.acenetfln.net/
1: 1: http://library.bendigo.latrobe.edu.au/
1: 1: http://10.16.1.178:15871/
1: 1: http://au.f403.mail.yahoo.com/
1: 1: http://www.students.dsu.edu/
1: 1: http://directory.virgilio.it/
1: 1: http://www.ntlib.nt.gov.au/
2: 1: http://www.picsearch.de/
4: 1: http://images.google.ie/
1: 1: http://10.43.80.19/
1: 1: http://www.snow.utoronto.ca/
1: 1: http://websearch.com.au/
1: 1: http://www.outlook8.com/
1: 1: http://www.cballarat.com.au/
1: 1: http://images.google.it/
1: 1: http://netconnect.looksmart.com.au/
1: 1: http://www.nuclear-diagnostics.com/
1: 1: http://fn1.tfn.net/
1: 1: https://131.170.150.3/
1: 1: http://www.rapidou.com/
1: 1: http://search1.vivisimo.com/
1: 1: http://mymail.graffiti.net/
1: 1: http://www.absolutearts.com/
1: 1: http://edweb.sdsu.edu/
1: 1: http://dash.ish.com.au/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://notes.usd353.com/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://rd.search.yahoo.com/
1: 1: http://be203-mail.mail.eudoramail.com/
1: 1: http://barrettp.customer.netspace.net.au/
1: 1: http://www.wwda.org.au/
1: 1: http://search.latam.yupimsn.com/
1: 1: http://www.business.com/
1: 1: http://digitalmarketing.ourprintshop.com/
1: 1: http://fr.altavista.com/
1: 1: http://search.msn.it/
1: 1: http://website.lineone.net/
1: 1: http://www.cyh.com/
1: 1: http://www.lang.ltsn.ac.uk/
1: 1: http://brk-exch-1.bnp.admin.tafe/
1: 1: http://thisday.uazone.net/
1: 1: http://10.177.36.244:15871/
1: 1: http://ww.google.co.nz/
1: 1: http://10.47.41.130:15871/
3: 1: http://images.google.lt/
1: 1: http://www.wwwomen.com/
1: 1: http://lawcrawler.findlaw.com/
1: 1: http://mamma28.mamma.com/
1: 1: http://www.citizenscape.wa.gov.au/
1: 1: http://www.google.co.za/
1: 1: xxxx:++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://pesquisa.clix.pt/
1: 1: http://www.artary.org/
22: 1: http://216.239.53.104/
1: 1: http://www.methana.com/
1: 1: http://myeweb.us/
1: 1: http://www.service.sa.gov.au/
1: 1: http://webct.unt.edu/
1: 1: http://www.nfaw.org/
1: 1: http://se.search.yahoo.com/
1: 1: http://hardy.netster.com/
1: 1: http://edvista.com/
1: 1: http://10.2.2.96:15871/
1: 1: http://admin.edna.edu.au/
1: 1: http://ala.asn.au/
1: 1: http://eslwideworld.com/
1: 1: http://aflutist.customer.netspace.net.au/
1: 1: http://64.4.16.250/
1: 1: http://www.distss.org.au/
1: 1: http://extranet.penrhos.wa.edu.au/
1: 1: http://www.schoolweb.missouri.edu/
1: 1: http://www.weather.com/
1: 1: http://mamma25.mamma.com/
1: 1: http://www.canterbury.nsw.gov.au/
1: 1: http://www.visitmelbourne.com/
2: 1: http://google/
1: 1: http://www.acfelcm.vic.edu.au/
1: 1: http://www.subudcanada.org/
1: 1: http://alltheweb.com/
1: 1: http://suche.lycos.de/
1: 1: http://yourcentral.tafe.wa.gov.au/
1: 1: http://ca.dir.yahoo.com/
1: 1: http://65.54.172.250/
1: 1: http://www.linkcenter.com/
1: 1: http://marksesl.com/
1: 1: http://www.artbrush.net/
1: 1: http://ps6.profusion.com/
1: 1: http://10.50.1.172:15871/
1: 1: http://www.directory.net/
1: 1: http://profiles.yahoo.com/
2: 1: http://it.images.search.yahoo.com/
1: 1: http://nuit/
1: 1: http://www.barrackht-p.schools.nsw.edu.au/
1: 1: http://msxml.infospace.com/
1: 1: http://www.dominion-web.com/
1: 1: http://ssiteaching.tafensw.edu.au/
1: 1: http://www.wsd1.org/
1: 1: http://www.kartoo.com/
1: 1: http://outlook.elthamcollege.vic.edu.au/
1: 1: http://www.aolsearch.com/
1: 1: http://www.richardsun.com/
1: 1: http://161.143.160.12:15871/
1: 1: http://www.communityartbank.org.au/
1: 1: http://hinduwebsite.com/
1: 1: http://search.msn.nl/
1: 1: http://www.keyword-tracker.com/
1: 1: http://www.vonna.com/
1: 1: http://au.f208.mail.yahoo.com/
1: 1: http://rose-crest.tripod.com/
1: 1: http://search.msn.co.jp/
1: 1: http://www2.warwick.ac.uk/
171: 1: http://cidb.ymrl.org.au/
1: 1: http://www.hispeed.rogers.com/
1: 1: http://www.qldwoman.qld.gov.au/
1: 1: http://search.goeureka.com.au/
1: 1: http://salp.squarenine.com.au/
1: 1: http://www.google.com.mt/
1: 1: http://www.ballarat.net.au/
1: 1: http://www.vatme.vic.edu.au/
1: 1: http://search.aol.ca/
1: 1: http://phil.mav.net/
1: 1: http://dragon-tree.freshlinks.net/
1: 1: http://www.learnlinks.com.au/
1: 1: http://partners.search.msn.com/
1: 1: http://www2.visitvictoria.com/
1: 1: http://www.google.com.ni/
1: 1: http://www.altavista.pl/
1: 1: http://ww.google.co.uk/
1: 1: http://64.4.26.250/
1: 1: http://www.preston.k12.id.us/
1: 1: http://www.ghslibrary.webfront.net.au/
1: 1: http://www.imdb.com/
1: 1: http://montal2003.tripod.com/
1: 1: http://us.f404.mail.yahoo.com/
1: 1: http://answerbus.coli.uni-sb.de/
1: 1: http://sg.dir.yahoo.com/
1: 1: http://advocacy-net.com/
1: 1: http://raptor.ntu.edu.au/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++/
9: 1: http://66.218.71.225/
1: 1: http://www.google.as/
1: 1: http://forum.kindergarten-workshop.de/
1: 1: http://users.hardnet.com.au/
1: 1: https://www.stratgroup.org/
1: 1: http://fr.images.search.yahoo.com/
2: 1: http://go.mail.ru/
1: 1: http://us.f130.mail.yahoo.com/
1: 1: http://www.a-travel-site.com/
1: 1: http://it.altavista.com/
1: 1: http://www.arts.yorku.ca/
1: 1: http://www.edvista.com/
1: 1: http://dlibrary.acu.edu.au/
1: 1: http://cdsearch.britannica.com/
1: 1: http://bvha.org/
1: 1: http://search.msn.se/
1: 1: http://www.staffs.ac.uk/
1: 1: http://www.vancouver.ca/
1: 1: http://192.168.0.1:3000/
1: 1: http://64.4.18.250/
1: 1: http://au.f213.mail.yahoo.com/
2: 1: http://images.google.com.ar/
1: 1: http://au.f415.mail.yahoo.com/
1: 1: http://www.priceminister.com-se.com/
1: 1: http://centralnet/
1: 1: http://www1.eboard.com/
1: 1: http://www.latinguia.com/
1: 1: http://ilor.com/
1: 1: xxxx:++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://joke.deep-depth-miner.com/
1: 1: http://10.0.0.13:3000/
1: 1: http://www.inchelium.wednet.edu/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://webmail.alphalink.com.au/
1: 1: http://www.city.vancouver.bc.ca/
1: 1: http://search.canoe.ca/
1: 1: http://wizard.yellowbrick.oz/
1: 1: http://us.f420.mail.yahoo.com/
1: 1: http://www.teachers.ash.org.au/
1: 1: http://hi-ho.excite.co.jp/
1: 1: http://www.geometry.net/
1: 1: http://www.lcc.edu.au/
1: 1: http://www.doglinks.it/
1: 1: http://websearch.money.cnn.com/
1: 1: http://www.knowle.connectfree.co.uk/
1: 1: http://www.members.tripod.com/
1: 1: news://news.virgin.net/
1: 1: http://www.mailorderamerica.com/
1: 1: http://www.cabrillo.cc.ca.us/
1: 1: http://www.omniseek.com/
1: 1: http://www.google.com.ua/
1: 1: http://172.31.1.71:15871/
1: 1: http://srd.yahoo.com/
1: 1: http://dmoz.com/
1: 1: http://2st.com.au/
1: 1: http://images.google.co.hu/
1: 1: http://search.f2.com.au/
1: 1: http://netlinks.slq.qld.gov.au/
1: 1: http://outlook.bhtafe.edu.au/
1: 1: http://69.69.9.6/
1: 1: xxxx:+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++/
1: 1: http://216.239.39.100/
1: 1: http://www.goodshepherd.com.au/
1: 1: http://www.pegs.vic.edu.au/
1: 1: http://www.skratta.net/
1: 1: http://www.parl.ns.ca/
1: 1: http://www.webeverything.co.uk/
4: 0: http://www/
46: 0: http://forum.watmm.com/
55: 0: http://skyscrapercity.com/
2: 0: http://www.amazon.com/
4: 0: http://connected/
34: 0: http://216.239.41.104/
3: 0: http://www.filemirrors.com/
2: 0: http://www.converse/
10: 0: http://beable.livejournal.com/
2: 0: http://www.almisbar.com/
1: 0: http://maskull.livejournal.com/
3: 0: http://littleowl.livejournal.com/
1: 0: http://sea2fd.sea2.hotmail.msn.com/
224: 0: http://www.livejournal.com/
7: 0: http://kyriacarlisle.livejournal.com/
1: 0: http://www.terravista.pt/
1: 0: http://bookmarks.mac.com/
98: 0: http://www.skyscrapercity.com/
1: 0: http://madrigaldelavera.net/
8: 0: http://www.vwt.org.au/
2: 0: http://websearch.naver.com/
2: 0: http://roosterbear.livejournal.com/
2: 0: http://buscador.lycos.es/
2: 0: http://peoplemaking/
1: 0: http://buscador.terra.es/
1: 0: http://myhome.naver.com/
1: 0: http://www.chinatown.com.au/
46: 0: http://www.antarcticvoyage.org/
2: 0: http://sucheaol.aol.de/
9: 0: http://antarcticvoyage.org/
27: 0: http://cedric.yarranet.net.au/
1: 0: http://www.fernschule-weber.de/
2: 0: http://converse/
16: 0: http://www.avantbrowser.com/
1: 0: http://203.17.69.66/
1: 0: e:/MET/
1: 0: wyciwyg://0/
1: 0: http://www.ryze.com/
27: 0: wysiwyg://0/
1: 0: http://lw9fd.law9.hotmail.msn.com/
21: 0: http://forum.thaivisa.com/
1: 0: http://64.4.36.250/
1: 0: http://groups.msn.com/
3: 0: http://www.askom.net.pl/
6: 0: http://216.109.117.135/
1: 0: http://rechercher.nomade.tiscali.fr/
1: 0: http://us.f600.mail.yahoo.com/
1: 0: http://beta.domainsponsor.com/
This report lists which queries people used in search engines to find the site.
Listing the top 30 queries by the number of requests, sorted by the number of requests.
reqs: pages: search term ----: -----: ----------- 323: 323: on this day 152: 152: free internet 136: 136: safeway 105: 105: this day in history 83: 83: city of yarra 70: 70: vietnamese culture 64: 64: vietnamese fonts 60: 60: free internet access 59: 59: vietnamese font 43: 43: on this day in history 43: 43: yarranet 39: 38: ar505enu.exe 34: 34: child rearing practices 32: 32: collingwood neighbourhood house 31: 31: women art 31: 31: yarra city council 25: 25: aaw.exe 24: 24: getting sponsorship 23: 23: coldest place on earth 23: 23: rosalie gascoigne 22: 22: australian women artists 21: 21: isabel davies 20: 20: vic roads 19: 19: australian women 19: 19: learning percentages 18: 18: related:www.rotten.com/today/ 18: 18: platypus costume 18: 18: sydney community college 17: 17: david barkley 16: 8: rockser.vxd 9242: 8947: [not listed: 6,809 search terms]
This report lists which words people used in search engines to find the site.
Listing the top 30 query words by the number of requests, sorted by the number of requests.
reqs: pages: search term -----: -----: ----------- 871: 868: in 791: 791: vietnamese 646: 633: on 628: 628: day 572: 572: this 559: 548: of 461: 461: and 424: 412: art 423: 418: australia 381: 365: melbourne 381: 372: internet 375: 372: learning 361: 345: the 352: 348: free 351: 351: history 337: 337: education 323: 323: australian 300: 297: women 266: 266: adult 238: 238: culture 234: 231: for 217: 217: child 201: 197: community 196: 191: to 189: 182: family 189: 189: online 147: 145: artists 145: 145: yarra 143: 140: city 141: 141: safeway 24149: 23217: [not listed: 5,592 search terms]
This report lists the vendors of visitors' browsers.
Listing browsers, sorted by the number of requests for pages.
no.: reqs: pages: browser ---: ------: -----: ------- 1: 151567: 41397: MSIE : 106012: 28950: MSIE/6 : 105915: 28926: MSIE/6.0 : 97: 24: MSIE/6.0b : 44013: 11904: MSIE/5 : 19516: 5382: MSIE/5.5 : 11642: 3542: MSIE/5.0 : 9275: 2212: MSIE/5.01 : 1386: 276: MSIE/5.22 : 542: 130: MSIE/5.16 : 190: 100: MSIE/5.00 : 331: 70: MSIE/5.21 : 371: 48: MSIE/5.17 : 149: 40: MSIE/5.15 : 223: 32: MSIE/5.14 : 123: 30: MSIE/5.13 : 98: 23: MSIE/5.23 : 74: 14: MSIE/5.12 : 3: 3: MSIE/5.05 : 89: 1: MSIE/5.0b1 : 1: 1: MSIE/5.1b1 : 1517: 526: MSIE/4 : 598: 345: MSIE/4.0 : 824: 168: MSIE/4.01 : 95: 13: MSIE/4.5 : 17: 9: MSIE/3 : 6: 4: MSIE/3.02 : 6: 3: MSIE/3.01 : 5: 2: MSIE/3.0 2: 12465: 10727: Netscape (compatible) 3: 12443: 8589: Mozilla : 1577: 377: Mozilla/1 : 62: 22: Mozilla/0 4: 7322: 5358: Scooter : 7322: 5358: Scooter/3 5: 3407: 2993: Googlebot : 3407: 2993: Googlebot/2 6: 3028: 2459: FAST-WebCrawler : 3028: 2459: FAST-WebCrawler/3 7: 2448: 2430: www.webwombat.com.au 8: 7586: 2215: Netscape : 3922: 1333: Netscape/4 : 231: 201: Netscape/4.5 : 226: 189: Netscape/4.0 : 719: 163: Netscape/4.78 : 203: 94: Netscape/4.77 : 905: 94: Netscape/4.7 : 130: 93: Netscape/4.75C-CCK-MCD : 247: 88: Netscape/4.79 : 141: 66: Netscape/4.51 : 165: 57: Netscape/4.04 : 147: 52: Netscape/4.75 : 123: 41: Netscape/4.08 : 117: 40: Netscape/4.8 : 211: 28: Netscape/4.73 : 98: 25: Netscape/4.76 : 55: 24: Netscape/4.77C-CCK-MCD : 29: 23: Netscape/4.05 : 56: 19: Netscape/4.72 : 22: 10: Netscape/4.74 : 21: 7: Netscape/4.73C-CCK-MCD : 30: 6: Netscape/4.61 : 3393: 793: Netscape/7 : 1720: 311: Netscape/7.0 : 836: 218: Netscape/7.1 : 664: 218: Netscape/7.02 : 171: 45: Netscape/7.01 : 2: 1: Netscape/7.0b1 : 255: 78: Netscape/6 : 86: 29: Netscape/6.2 : 83: 26: Netscape/6.2.3 : 46: 10: Netscape/6.2.1 : 29: 9: Netscape/6.2.2 : 2: 2: Netscape/6.0 : 5: 1: Netscape/6.01 : 4: 1: Netscape/6.1 : 11: 6: Netscape/3 : 2: 2: Netscape/3.0 : 5: 1: Netscape/3.04 : 1: 1: Netscape/3.01 : 2: 1: Netscape/3.0N : 1: 1: Netscape/3.01Gold 9: 1881: 1867: Art-Online.com 0.9(Beta) 10: 1488: 1282: ia_archiver 11: 1082: 1052: Microsoft URL Control - 6.00.8862 12: 814: 814: Java1.4.0_01 13: 598: 574: http: : 577: 558: http://WebSearch : 21: 16: http://www 14: 541: 540: sitecheck.internetseer.com (For more info see: http: : 541: 540: sitecheck.internetseer.com (For more info see: http://sitecheck 15: 506: 496: TurnitinBot : 506: 496: TurnitinBot/1 16: 795: 396: NPBot (http: : 795: 396: NPBot (http://www 17: 220: 215: Speedy Spider (http: : 220: 215: Speedy Spider (http://www 18: 211: 193: msnbot : 211: 193: msnbot/0 19: 823: 163: Opera : 675: 123: Opera/7 : 122: 37: Opera/6 : 17: 3: Opera/5 20: 168: 156: dloader(NaverRobot) : 168: 156: dloader(NaverRobot)/1 21: 131: 130: Wget : 131: 130: Wget/1 22: 122: 122: ESLoop : 122: 122: ESLoop/0 23: 230: 113: appie : 230: 113: appie/1 24: 102: 102: Program Shareware 1.0.9 25: 114: 80: Zao : 114: 80: Zao/0 26: 132: 75: LinkWalker 27: 74: 74: puf : 74: 74: puf/0 28: 114: 69: Konqueror : 114: 69: Konqueror/3 29: 105: 68: psbot : 105: 68: psbot/0 30: 76: 55: QuepasaCreep v0.9.14 31: 51: 51: Industry Program 1.0.2 32: 51: 51: Program Shareware 1.0.6 33: 48: 48: P.Arthur 1.1 34: 48: 46: Buscaplus Robi : 48: 46: Buscaplus Robi/1 35: 46: 45: NaverBot 36: 48: 44: icsbot-0.1 37: 98: 38: WebTV : 88: 33: WebTV/2 : 10: 5: WebTV/1 38: 66: 33: webcollage : 66: 33: webcollage/1 39: 30: 30: IE : 30: 30: IE/5 40: 32: 30: Internet Ninja 6.0 41: 29: 29: Microsoft-WebDAV-MiniRedir : 29: 29: Microsoft-WebDAV-MiniRedir/5 42: 69: 29: MSProxy : 69: 29: MSProxy/2 43: 42: 28: NutchCVS : 42: 28: NutchCVS/0 44: 27: 27: CerberianDrtrs : 27: 27: CerberianDrtrs/Version-3 45: 27: 27: W3CLineMode : 27: 27: W3CLineMode/5 46: 27: 26: libwww-perl : 27: 26: libwww-perl/5 47: 41: 24: NetResearchServer : 41: 24: NetResearchServer/2 48: 22: 22: ht: : 22: 22: ht://check/1 49: 44: 22: Baiduspider+(+http: : 44: 22: Baiduspider+(+http://www 50: 22: 20: kuloko-bot : 22: 20: kuloko-bot/0 51: 41: 19: NutchOrg : 41: 19: NutchOrg/0 52: 17: 17: LinkScan : 17: 17: LinkScan/11 53: 27: 17: Infoseek SideWinder : 27: 17: Infoseek SideWinder/2 54: 16: 16: Linbot : 16: 16: Linbot/1 55: 14: 14: Links Manager 1.1 : http: : 14: 14: Links Manager 1.1 : http://www 56: 15: 14: larbin_2.6.3 larbin2.6.3@unspecified.mail 57: 13: 13: Jakarta HTTP Client : 13: 13: Jakarta HTTP Client/2 58: 12: 12: Xenu Link Sleuth 1.2d 59: 11: 11: LinkLint-checkonly : 11: 11: LinkLint-checkonly/2 60: 18: 11: Microsoft Data Access Internet Publishing Provider Protocol Discovery 61: 156: 11: Galeon : 156: 11: Galeon/1 62: 9: 9: Lynx : 9: 9: Lynx/2 63: 9: 9: MARTINI 64: 8: 8: Xenu Link Sleuth 1.2e 65: 7: 7: : 7: 7: / 66: 7: 7: Fbot : 7: 7: Fbot/1 67: 10: 7: Java : 10: 7: Java/1 68: 6: 6: Indiana U Web 69: 12: 6: Tutorial Crawler 1.4 (http: : 12: 6: Tutorial Crawler 1.4 (http://www 70: 6: 6: RPT-HTTPClient : 6: 6: RPT-HTTPClient/0 71: 6: 6: Szukacz : 6: 6: Szukacz/1 72: 12: 6: NetMechanic V4.0 73: 5: 5: Lotus-Notes : 5: 5: Lotus-Notes/4 74: 5: 5: Xenu Link Sleuth 1.2b 75: 32: 5: IE5 . 76: 5: 5: Mozi! 77: 5: 5: Nokia3510i : 5: 5: Nokia3510i/1 78: 4: 4: LinkScan Server : 4: 4: LinkScan Server/6 79: 8: 4: Openbot : 8: 4: Openbot/3 80: 4: 4: Computer_and_Automation_Research_Institute_Crawler nospamspidernospam@spider.ilab.sztakinospam.hunospam 81: 4: 4: (Teradex Mapper; mapper@teradex.com; http: : 4: 4: (Teradex Mapper; mapper@teradex.com; http://www 82: 4: 4: Crawl_Application 83: 4: 4: Perl-Win32::Internet : 4: 4: Perl-Win32::Internet/0 84: 3: 3: Microsoft URL Control - 6.00.8169 85: 38: 3: Wavepluz Mozilla : 38: 3: Wavepluz Mozilla/5 86: 3: 3: Test1.0 87: 3: 3: Libby_1.1 : 3: 3: Libby_1.1/libwww-perl/5 88: 5: 3: Gaisbot : 5: 3: Gaisbot/3 89: 3: 3: Email Spider by AlexW 90: 15: 3: holy_teacher 91: 2: 2: Microsoft Internet Explorer : 2: 2: Microsoft Internet Explorer/4 92: 3: 2: MSNBOT : 3: 2: MSNBOT/0 93: 3: 2: Zeus : 3: 2: Zeus/32822 94: 4: 2: Irvine : 4: 2: Irvine/1 95: 2: 2: EmailSiphon 96: 2: 2: My Session 1 97: 2: 2: IP*Works! V5 HTTP : 2: 2: IP*Works! V5 HTTP/S 98: 2: 2: SonyEricssonT68 : 2: 2: SonyEricssonT68/R201A 99: 2: 2: MFC_Tear_Sample 100: 2: 2: InternetLinkAgent : 2: 2: InternetLinkAgent/3 101: 4: 2: Scrubby : 4: 2: Scrubby/2 102: 2: 2: PlantyNet_WebRobot_V1.9 dhkang@plantynet.com 103: 2: 2: LWP::Simple : 2: 2: LWP::Simple/5 104: 4: 2: Mediapartners-Google : 4: 2: Mediapartners-Google/2 105: 2: 2: asterias; 2.0 106: 2: 2: LinkSweeper : 2: 2: LinkSweeper/1 107: 16: 2: Microsoft Data Access Internet Publishing Provider DAV 1.1 108: 2: 2: SURF 109: 27: 1: DA : 27: 1: DA/5 110: 1: 1: uyynljjx8g jnbfkb t nlwbnnvwvegv tp 111: 1: 1: Enter new UA String or choose a common one. Then press ENTER 112: 1: 1: xhlbcwejarpbewlksrsqyfs sr bhbbfmsmBy 113: 1: 1: 00000668.htm 114: 1: 1: xp ommMkb M5c febjycbjmnc 115: 1: 1: gdvf cmynge1svwi woehmpyowbyumo1 116: 1: 1: lwp-trivial : 1: 1: lwp-trivial/1 117: 1: 1: Download Ninja 7.0 118: 1: 1: alv44hdadtjoxiMhohtcoc 119: 1: 1: Nokia6610 : 1: 1: Nokia6610/1 120: 1: 1: gopskkhiIItiaI2g2cperorrmksehqni 121: 1: 1: Jakarta Commons-HttpClient : 1: 1: Jakarta Commons-HttpClient/2 122: 1: 1: mtq kbms a buskkbNavNuwnxqsa 123: 2: 1: w3m : 2: 1: w3m/0 124: 1: 1: tutmjcRR cplp cpnrwwxtxaenRgqys 125: 1: 1: InfoLink : 1: 1: InfoLink/1 126: 1: 1: Internet Explorer 127: 1: 1: eeltlwtqtmoux yferEgimirf fuc ntmrEgje 128: 1: 1: Verity-URL-Gateway : 1: 1: Verity-URL-Gateway/3 129: 5: 1: peter gonzales 130: 1: 1: kytrivrsysqifyinddktgigfiggyyvgvuygg 131: 1: 1: invd llsemdillggde6uik iJurhwe 132: 1: 1: rhn0h r0xjnxvskybmeqk 133: 1: 1: PROJECT1 134: 1: 1: Program Shareware 1.0.3 135: 1: 1: ydudw2frdhwlrorogoVrasyuqkV2diwonsl 136: 1: 1: afnbuqcgcnmihago2auojsm 137: 1: 1: Missigua Locator 1.9 138: 1: 1: lc : 1: 1: lc/$ROADS::Version 139: 1: 1: uydltgbmqvsghhknrvyhdmkf v 140: 1: 1: Links SQL (http: : 1: 1: Links SQL (http://gossamer-threads 141: 22: 1: Microsoft Data Access Internet Publishing Provider Cache Manager 142: 1: 1: gu7f aaqakjde7rrgjgrex gtnct pex 143: 1: 1: sina-spider fzhe@163.net 144: 1: 1: ggibqitTncnvncoyupTkvqtbukcs 145: 1: 1: frjhiiq qjvokodrqlPoiqPPwhakd 146: 1: 1: Yqn usdqltkYqduYptmavYwlughhmwq pbxqslg 147: 1: 1: Under the Rainbow 2.2 148: 1: 1: fsddah8smlwprphcmufwlutugemhcw 149: 1: 1: Gekko : 1: 1: Gekko/1 150: 1: 1: Green Research, Inc. 151: 1: 1: Java1.2.2 152: 1: 1: Schmozilla : 1: 1: Schmozilla/v9 153: 1: 1: gvasgltcpncquhtuqbe biaoqayxauhlp ng 154: 1: 1: s9bhnagkcng rjgp9tixdnsqiaknfasyxd 155: 1: 1: Vivante Link Checker (http: : 1: 1: Vivante Link Checker (http://www 156: 1: 1: ixbqBoioffdgdfdhvhdxkreopurhrdhdueeubv 157: 1: 1: mopopgoq0rypnBuqgmg0qi b0ecq 158: 1: 1: dteug3iyaae3fgdikgvibnmgbqegd tfblaDkeo 159: 1: 1: htbtrxtjxpdkud0xmkjeu o0fjwbco 160: 1: 1: Sqworm : 1: 1: Sqworm/2 161: 1: 1: jsfivmspsnrsnOvo99ofmnoiOriqjr 162: 1: 1: WebCopier v3.5 163: 1: 1: hgh4rbdeSbbwcajxlq4yswtyct4nx 164: 1: 1: llvsfgqwcmgjfrmogcsl eenoslaowp 165: 1: 1: vbegowrvr n7 Buwofqu 166: 1: 1: fFrbld mebftxfmwye v 167: 1: 1: lLashL uhikj2dveLrsehuis wxmcwkbLcg 168: 1: 1: wqgewipifeskyjacnbgtjaclcxlbk 169: 2: 1: webbase : 2: 1: webbase/5 170: 1: 1: v tgshvaosrb4numoursjetjgkrdqqbdqu 171: 1: 1: Java1.3.1 172: 1: 1: sinnoixh7 qrxl sixhleoddyyxtbc 173: 1: 1: uvbixxultcoq notRe bRwtxugelkgbnnj99 174: 1: 1: Inter-Coastal Info Server 175: 1: 1: jqhyfdfidqbaqV9bvjqiyhmffh9vy9xjyt 176: 1: 1: dvlvgpfa eln9aufljewluuhkqplru 177: 1: 1: combine : 1: 1: combine/0 178: 2: 1: FavOrg 179: 1: 1: mli nq vly dcSewpkStvf1ahmp 180: 1: 1: m5 hej5y qlfgal vvhbfguqhtkss5 181: 1: 1: och5vpceoxvbw raArghdhojdtuAv 182: 2: 1: NCSA Beta 1 (http: : 2: 1: NCSA Beta 1 (http://vias 183: 1: 1: y cvCkt u0psnhmqhC tiqlcoo qttmlnb 184: 2: 1: CyberSpyder Link Test : 2: 1: CyberSpyder Link Test/2 185: 4: 1: Gigabot : 4: 1: Gigabot/1 186: 1: 1: yrejqHisb5jn vc covjoobrd 187: 1: 1: AOLserver-Tcl : 1: 1: AOLserver-Tcl/3 188: 1: 1: 00000375.htm 189: 1: 1: Larry's Link Checker : 1: 1: Larry's Link Checker/0 190: 1: 1: tugkoppbsaeotfqef5e5kwMohftwmh wnkyl 191: 17: 0: Avant Browser (http: 192: 3: 0: ImageBot 193: 2: 0: FreshDownload 194: 7: 0: Microsoft Data Access Internet Publishing Provider DAV 195: 12: 0: Moozilla 196: 4: 0: LeechGet 197: 18: 0: larbin_2.6.3 (larbin2.6.3@unspecified.mail) 198: 3: 0: Python-urllib 199: 2: 0: Openfind data gatherer, Openbot 200: 1: 0: contype 201: 1: 0: Look.com 202: 12: 0: IDA 203: 4: 0: oBot 204: 3: 0: Slurp 205: 1: 0: WebFilter Robot 1.0 206: 1: 0: Internet Spider V7.0 207: 4: 0: GetRight 208: 1: 0: FAST-RealWebCrawler 209: 1: 0: Infomine Virtual Library Crawler 210: 1561: 0: Googlebot-Image 211: 1: 0: COMBINE 212: 91: 0: Star Downloader 213: 1: 0: sina-spider (fzhe@163.net) 214: 4: 0: Computer_and_Automation_Research_Institute_Crawler (nospamspidernospam@spider.ilab.sztakinospam.hunospam) 215: 7: 0: Vagabondo
This report lists the operating systems used by visitors.
Listing operating systems, sorted by the number of requests for pages.
no.: reqs: pages: OS ---: ------: -----: -- 1: 153586: 42136: Windows : 57243: 15743: Windows XP : 38268: 10486: Windows 98 : 35581: 9415: Windows 2000 : 8576: 2552: Windows NT : 8907: 2216: Windows ME : 4690: 1643: Windows 95 : 283: 64: Unknown Windows : 30: 9: Windows CE : 8: 8: Windows 32-bit 2: 34533: 29758: OS unknown 3: 16591: 11911: Known robots 4: 8202: 1686: Macintosh : 8192: 1684: Macintosh PowerPC : 10: 2: Macintosh 68k 5: 994: 365: Unix : 805: 302: Linux : 119: 45: SunOS : 64: 16: BSD : 5: 1: OSF1 : 1: 1: HP-UX 6: 98: 38: WebTV
This report lists the HTTP status codes of all requests.
Listing status codes, sorted numerically.
reqs: status code
------: -----------
193805: 200 OK
754: 206 Partial content
5494: 301 Document moved permanently
8969: 302 Document found elsewhere
24540: 304 Not modified since last retrieval
22: 400 Bad request
624: 401 Authentication required
82: 403 Access forbidden
8863: 404 Document not found
86: 405 Method not allowed
54: 500 Internal server error
1: 501 Request type not supported
This report lists the directories from which files were requested. (The figures for each directory include all of its subdirectories.)
Listing directories, sorted alphabetically.
reqs: pages: %bytes: directory
-----: -----: ------: ---------
7268: 4411: 1.82%: /acacia/
10: 10: : /acetech/
58613: 39627: 19.23%: /aceweb/
127: 106: : /adlearn/
1031: 380: 0.70%: /adulted/
149: 92: 0.01%: /agws/
56: 0: : /analog/
24: 24: 0.01%: /awstats/
1753: 516: 0.32%: /banh/
1: 1: : /beaufort/
2291: 745: 0.57%: /burnley/
850: 145: 0.08%: /ccac/
4959: 2440: 1.39%: /cedric/
7: 7: : /cidb/
161: 107: 0.01%: /clubs/
872: 322: 0.21%: /cnh/
391: 389: 0.01%: /council/
1674: 1205: 1.31%: /cwmacfe/
188: 77: 0.36%: /domainbakery/
2962: 431: 0.27%: /e-learning/
1: 1: : /grainandgrape/
88: 0: : /graphics/
131: 74: 0.02%: /hanover/
221: 163: 0.02%: /hg/
2: 2: : /hippyaustralia/
507: 406: 0.18%: /holdensnh/
209: 135: 0.08%: /housingjustice/
4: 4: : /hub/
3004: 1: 0.03%: /icons/
254: 237: 0.01%: /lauristina/
62: 33: 0.01%: /lwc/
152: 152: 0.09%: /manual/
2415: 198: 0.22%: /nhouses/
265: 159: 0.06%: /nlt/
17054: 17049: 3.51%: /onthisday/
4984: 2028: 1.28%: /phill/
243: 100: 0.04%: /phonebook/
924: 402: 39.44%: /public/
1346: 489: 0.17%: /purplesage/
622: 241: 0.11%: /railway/
1: 1: : /rec/
133: 107: 0.03%: /richmondps/
5473: 1387: 0.51%: /sarah/
12: 9: : /searcher/
114: 83: 0.02%: /shb/
2095: 0: 0.14%: /shell/
345: 118: 0.12%: /spensley/
637: 150: 0.39%: /tim/
2667: 437: 0.29%: /vivatimor/
2475: 955: 1.94%: /webwords/
52714: 9129: 17.01%: /womar/
22921: 2696: 7.17%: /yarranet/
4855: 815: 0.49%: /yarraonline/
7: 0: : [no directory]
8773: 2108: 0.32%: [root directory]
2: 2: : http://
This report lists the files that caused requests to be redirected to another file. (Usually directories with the final slash missing, or CGI scripts that forced redirections.)
Listing the top 30 files by the number of redirected requests, sorted by the number of redirected requests.
reqs: file ----: ---- 8639: /shell/onthisday/onthisday.cgi 1546: /shell/onthisday/onthisday.cgi?submit=today 934: /library/ 232: /rmsn/rainbownet.htm 176: /aceweb 159: /shell/generic/netherlog/nether-log.pl 147: /shell/generic/formail.pl 135: /lauristina 106: /onthisday 97: /aceweb/econf/2003 79: /youthlink/zahra/images/ush.jpg 76: /webpac/ 69: /library 60: /womar 56: /yarranet.htm 55: /cnh 52: /rmsn/~hdg4529.htm 40: /rmsn/pages/supgroup.htm 39: /peoplemaking 38: /sarah/healesville 37: /librarylink/ 34: /railway 33: /rmsn/ 33: /webwords 30: /aceweb/sharing 29: /burnley 24: /ccac 22: /cedric 22: /webpac 20: /aceweb/mailarch 20: /sarah/cnh 2970: [not listed: 1,446 files]
This report lists the files that caused failures, for example files not found.
Listing files with at least 2 failed requests, sorted alphabetically.
reqs: file ----: ---- 3: / 2: /.au/phill/fudge/ 2: /1008htm 2: /2003/schedub.htm 91: /_vti_bin/owssvr.dll 61: /_vti_bin/owssvr.dll?UL=1&ACT=4&BUILD=2614&STRMVER=4&CAPREQ=0 25: /_vti_bin/owssvr.dll?UL=1&ACT=4&BUILD=4219&STRMVER=4&CAPREQ=0 34: /_vti_bin/shtml.exe/_vti_rpc 34: /_vti_inf.html 5: /about.htm 3: /about.html 3: /about_history.html 3: /about_policy_acc_use.html 3: /about_policy_content.html 3: /about_policy_disclaimer.html 4: /about_policy_terms.html 3: /aboutthecentre.htm 3: /aboutus.html 3: /acacia.htm 6: /acacia/acacia11.gif 2: /acacia/ccc 2: /acacia/ccc/ 5: /acacia/csrdo/ahome.htm 17: /acacia/csrdo/fastcounter 14: /acacia/csrdo/logoshowad 3: /acacia/fkamrc 15: /acacia/fkamrc/fkamrc.htm 3: /acacia/hoanien/hoanien.htm 2: /acacia/resource.rearing.htm 3: /acacia/resource/favicon.ico 4: /acacia/resource/qt-logo.gif 4: /acacia/resource/religion.htm- 2: /ace= 2: /acewb/econf/2003/schedule.htm 4: /acewbb/econf/ 5: /acewbb/econf/2003/schedule.htm 2: /acewbb/econf/2003/scredule.htm 3: /acewbb/econg2003/schedule.htm/ 21: /aceweb/ 6: /aceweb/acfe.html 18: /aceweb/clara/whiterock.jpg 6: /aceweb/ecomf/2003/sckedule.htm 2: /aceweb/econf/2003/=20 3: /aceweb/econf/2003/> 3: /aceweb/econf/2003/favicon.ico 3: /aceweb/econf/2003/ind= 2: /aceweb/econf/2003/index.htm> 5: /aceweb/econf/2003/index/htm 2: /aceweb/econf/2003/schedule.htm/ 1022: /aceweb/econf/2003/schedule_currentdraft_files/econf.css 1076: /aceweb/econf/2003/schedule_draft_files/econf.css 1028: /aceweb/econf/2003/schedule_files/econf.css 3: /aceweb/econf/2003/shedule.htm 2: /aceweb/econf/2003/virtual_t 16: /aceweb/econf/2003/www.agedcareoz.com.au 3: /aceweb/econf/2003_schedule.htm 3: /aceweb/econf/</font 2: /aceweb/econf/conf_schedule2.html</b 4: /aceweb/econf/conf_schedule2.html=20 31: /aceweb/econf/erin.mccuskey@yum.ballarat.net.au 31: /aceweb/econf/michael.gwyther@yarranet.net.au 6: /aceweb/econf/wheretonowscenarios_files/filelist.xml 34: /aceweb/econf/www.enabling.org 2: /aceweb/econg2003/schedule.htm/ 2: /aceweb/eliteracies/dal...edober.htm 2: /aceweb/eliteracies/dale.html 5: /aceweb/eliteracies/dalegenealogy/boddington_files/filelist.xml 2: /aceweb/eliteracies/dalegenealogy/ps01/ps01_060.htm 2: /aceweb/eliteracies/dalegenealogy/ps01/ps01_176.htm 2: /aceweb/eliteracies/dalegenealogy/ps01/ps01_178.htm 2: /aceweb/eliteracies/dalegenealogy/ps01/ps01_183.htm 2: /aceweb/eliteracies/dalegenealogy/ps01/ps01_184.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_006.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_007.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_010.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_019.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_025.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_064.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_159.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_161.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_229.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_230.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_231.htm 2: /aceweb/eliteracies/dalegenealogy/wc01/wc01_243.htm 3: /aceweb/eliteracies/dalegenealogy/wc01/wc01_250.htm 2: /aceweb/eliteracies/dalegenealogy/wc_idx/idx001.htm 2: /aceweb/eliteracies/dalegenealogy/wc_idx/sur.htm 3: /aceweb/eliteracies/genealogy/22janlyntree/wc_toc.htm 7: /aceweb/eliteracies/genealogy/eb/eliteracies/genealogy/ancestors.html 2: /aceweb/eliteracies/genealogy/freeman2.html 2: /aceweb/eliteracies/genealogy/howard2.html 5: /aceweb/eliteracies/genealogy/pedigreejan2000.html 2: /aceweb/eliteracies/genealogy/ps01/ps01_001.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_002.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_003.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_004.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_005.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_006.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_008.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_009.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_011.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_012.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_013.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_014.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_016.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_017.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_018.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_019.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_020.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_022.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_023.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_024.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_025.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_026.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_027.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_028.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_029.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_030.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_031.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_033.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_035.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_036.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_042.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_045.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_048.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_051.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_052.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_053.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_054.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_055.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_056.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_057.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_058.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_060.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_061.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_062.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_063.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_064.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_065.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_069.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_070.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_076.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_078.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_080.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_081.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_082.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_084.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_086.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_087.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_088.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_089.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_090.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_091.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_093.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_094.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_095.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_096.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_097.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_099.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_101.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_102.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_103.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_104.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_105.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_106.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_107.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_108.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_109.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_110.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_111.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_112.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_113.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_114.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_115.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_116.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_117.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_118.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_119.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_120.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_121.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_122.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_126.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_127.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_128.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_130.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_131.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_132.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_133.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_134.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_136.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_137.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_138.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_141.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_142.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_143.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_146.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_148.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_159.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_160.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_162.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_163.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_164.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_165.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_173.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_174.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_175.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_178.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_179.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_180.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_181.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_182.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_185.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_186.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_187.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_188.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_189.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_190.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_208.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_212.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_220.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_221.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_222.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_223.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_224.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_225.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_237.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_238.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_261.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_262.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_263.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_265.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_266.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_267.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_269.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_272.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_273.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_274.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_275.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_278.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_279.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_280.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_281.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_282.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_283.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_284.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_285.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_290.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_293.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_336.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_387.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_388.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_389.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_390.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_391.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_392.htm 3: /aceweb/eliteracies/genealogy/ps01/ps01_396.htm 2: /aceweb/eliteracies/genealogy/ps01/ps01_456.htm 4: /aceweb/eliteracies/genealogy/wc_idx/idx001.htm 3: /aceweb/eliteracies/genealogy/wc_idx/sur.htm 25: /aceweb/eliteracies/genealogy/wc_toc.htm 4: /aceweb/eliteracies/genealogy/www.geo.ed.ac.uk/scotgaz/features/featurefirst/49.html 6: /aceweb/greece/amorgos.html 2: /aceweb/greece/inddex.html 9: /aceweb/lit_now/homepage.htm 5: /aceweb/lit_now/ln0196/contents.htm 8: /aceweb/lit_now/ln0196/javed.htm 4: /aceweb/lostlibrary/museum.html 2: /aceweb/lote/br_w95/http 5: /aceweb/lote/br_w95/http;/www.vnisoft.com/english/webmast.html 10: /aceweb/lote/br_w95/mie1.htm 2: /aceweb/lote/br_wnt/http;/www.vnisoft.com/english/webmast.html 11: /aceweb/lote/general/langmod.html 11: /aceweb/lote/general/unicode.htm 12: /aceweb/lote/general/unicode.html 9: /aceweb/lote/loteit.html 2: /aceweb/mailarch/00000954.html 11: /aceweb/mailarch/00001148.htm+chicago 2: /aceweb/mailarch/3d"http://www.volunteer.com.au" 3: /aceweb/mailarch/3d"mailto:tartakover@hotmail.com" 5: /aceweb/online/presentation/www.acenetfln.net 7: /aceweb/online/presentation/www.enabling.org/grassroots 6: /aceweb/projectnews.html 6: /aceweb/provider/hawthorn_community_education_project_inc.html 3: /aceweb/sharing/ 2: /aceweb/sharing/ / 2: /acfe.htm 3: /acfecwm 6: /acfecwm/ 7: /acfecwm/netresults/jennymid.html 3: /acfecwm/netresults/mhls_esl.htm 3: /acfecwm/netresults/mhls_esl.html 16: /acfecwm/netresults/netwelcome.html 5: /acfecwm/netresults/wendymid.html 8: /adlearn/adtime.htm 2: /adlearn/nell/disk1/mvc-003s.jpg 3: /adlearn/nell/disk1/mvc-014s.jpg 5: /adlearn/nell/disk4/mvc-001s.jpg 3: /adlearn/nell/disk5/mvc-005s.jpg 3: /adlearn/nell/disk5/mvc-006s.jpg 4: /adlearn/nell/disk6/mvc-011s.jpg 12: /adlearn/nell/disk7/mvc-003s.jpg 3: /adlearn/nell/disk7/mvc-005s.jpg 4: /adlearn/nell/disk7/mvc-006s.jpg 3: /adlearn/nell/disk8/mvc-004s.jpg 4: /adlib/server.cgi/1453192029932115 4: /adlib/server.cgi/160979251896380 4: /adlib/server.cgi/970227736349459 3: /adulted/acenet 3: /adulted/acenet/ 3: /adulted/acenet/chunky/ourorganisation.htm 2: /adulted/acenet/craig/ 2: /adulted/acenet/craig/index.htm 3: /adulted/acenet/fridayafternoon/fripmcae.html 4: /adulted/acenet/ge_web/cae_ge.html 2: /adulted/acenet/index.htm 2: /adulted/acenet/links.htm 2: /adulted/acenet/margarita 2: /adulted/acenet/margarita/ 2: /adulted/acenet/margarita/index.htm 2: /adulted/acenet/portfairy/ 2: /adulted/acenet/portfairy/holidaze_htmlportfairy.htm 2: /adulted/acenet/sandro/ 2: /adulted/acenet/sandro/index.htm 3: /adulted/acenet/students.htm 19: /adulted/alw2000.html 4: /adulted/chunky/ourorganisation.htm 7: /adulted/links.htm 7: /ahome.htm 2: /archives/opinion/imgoff; 2: /archives/opinion/imgon; 15: /banh/banh 7: /banh/banh.htm 3: /banhinc.htm 2: /banner.htm 3: /bookings.html 3: /bpullen 6: /bpullen/ 3: /burnley/care.html 2: /burnley/children.html 20: /business/ab.htm 3: /c:/my documents/war-nov2001/diary/star-power.htm 6: /c:/my documents/war-nov2001/diary/womar1.htm 17: /carlcont/ccfront.asp 40: /carlcont/ccfront.htm 3: /carlcont/ccinfo.htm 13: /carlcont/ccmigran.htm 3: /carlcont/ccshort.htm 7: /cedric/ararat 2: /cedric/ararat/students/john 6: /cedric/balleast/c/friday.htm 7: /cedric/balleast/default.htm 5: /cedric/balleast/emag/rr.htm 2: /cedric/balleast/image2.gif 5: /cedric/balleast/pics/tint.gif 3: /cedric/balleast/roadrule/rra11.htm 2: /cedric/balleast/sportlife/cricket/odi_avs_bat_aus-alltime.html 2: /cedric/balleast/sportlife/cricket/test_record_aus.html 9: /cedric/bu3a/bu3a.htm 4: /cedric/cedchw.htm 3: /cedric/clunes/clunes.htm 3: /cedric/clunes/michael 20: /cedric/clunes/michael/ 3: /cedric/dayles/dayles.htm 3: /cedric/donald/donaldregion.htm 9: /cedric/hu3a/home.htm 9: /cedric/hub 3: /cedric/stawell/ 4: /cedric/stawell/index.htm 2: /cfeet 2: /cfeet/cfeet01.htm 25: /cfeet/neisnet.htm 3: /cgi-bin/form.cgi 7: /cgi-bin/form.pl 34: /cgi-bin/formmail.cgi 45: /cgi-bin/formmail.pl 15: /cgi-bin/formmail/formmail.cgi 19: /cgi-bin/formmail/formmail.pl 3: /cgi-bin/mail.cgi 7: /cgi-bin/mail.pl 2: /cgi-local/form.cgi 2: /cgi-local/form.pl 9: /cgi-local/formmail.cgi 10: /cgi-local/formmail.pl 2: /cgi/form.pl 2: /chldcare.html 2: /classes.html 2: /clubs/sealyham/main.htm 4: /clubs/sealyham/sealengb.htm 67: /clubs/sealyham/sealy_hm.htm 12: /com_ann.htm 2: /comingup.html 4: /community.html 4: /contact.html 4: /contactus.htm 3: /council/appendix.htm 4: /council/arts.htm 11: /council/map02.htm 5: /council/map04.htm 9: /council/open.htm 2: /council/openindx.htm 2: /council/shopindx.htm 2: /cwmacfe/html/memo/0300299.htm 3: /cwmacfe/netresults/ 4: /design_host.html 2: /diary.htm 2: /disclaim.html 17: /e-learning 126: /e-learning/ 5: /e-learning/gen.htm 6: /e-learning/heritage.htm 5: /e-learning/images/bulletinboard.gif 2: /e-learning/images/bulletinboard2.gif 3: /e-learning/images/communitysnapshot.gif 2: /e-learning/images/elearnback.jpg 208: /e-learning/images/elearnsmallwhiteback.gif 4: /e-learning/images/emailus.gif 3: /e-learning/images/greenbutoff.gif 3: /e-learning/images/greenlines.gif 5: /e-learning/images/home.gif 3: /e-learning/images/infromationforstudents.gif 5: /e-learning/images/partners.gif 3: /e-learning/images/program.gif 3: /e-learning/images/tafevc.gif 3: /e-learning/images/twowomen.jpg 4: /e-learning/images/yarrahosted.gif 15: /e-learning/index.htm 2: /e-learning/launch.htm 2: /e-learning/onlinelearn.htm 4: /e-learning/partners.htm 2: /e-learning/powerpoint/elclaunch/img003.jpg 3: /e-learning/powerpoint/elclaunch/last.gif 3: /e-learning/powerpoint/elclaunch/space.gif 6: /e-learning/psyc.htm 8: /e-learning/snapshot.htm 4: /e-learning/studentinfo.htm 4: /e-learning/terms.htm 3: /e-learning/train.htm 6: /e-learning/tutor.htm 23: /e-learning/wwwboard 9: /e-learning/wwwboard/ 4: /e-learning/wwwboard/images/home2.gif 8: /e-learning/wwwboard/messages/ 3: /e-learning/wwwboard/messages/14.html 3: /e-learning/wwwboard/messages/18.html 3: /e-learning/wwwboard/messages/31.html 3: /e-learning/wwwboard/messages/33.html 2: /e-learning/wwwboard/messages/41.html 3: /e-learning/wwwboard/messages/50.html 3: /e-learning/wwwboard/messages/51.html 4: /e-learning/wwwboard/messages/62.html 3: /e-learning/wwwboard/messages/64.html 8: /e-learning/wwwboard/messages/78.html 3: /eslclass.html 2: /exec/obidos/ats-query-page/ref=b_tn_bh_bo/104-6249353-2883139 3: /exhibitions.htm 3: /fairfield/poswomen.htm 3: /formmail.php 5: /gen.htm 3: /hallhire.htm 2: /hanover/hanover_files/filelist.xml 13: /help_yn.htm 3: /heritage.htm 3: /history.htm 2: /holden.html 5: /holdensnh/2homepage.html 9: /holdensnh/asmahomepage.html 2: /holdensnh/coming to aust_files/filelist.xml 3: /hosted.html 2: /housingjustice/tor.html 2: /images/arrow_up.gif 5: /images/bgfr.gif 9: /images/but_links.gif 10: /images/but_progact.gif 10: /images/but_providers.gif 8: /images/but_rc.gif 9: /images/but_region.gif 4: /images/but_spare.gif 8: /images/but_whatsnew.gif 4: /images/butx_links.gif 4: /images/butx_progact.gif 5: /images/butx_providers.gif 4: /images/butx_rc.gif 4: /images/butx_region.gif 4: /images/butx_whatsnew.gif 3: /images/communitysnapshot2.gif 5: /images/front_left.gif 4: /images/front_right.gif 5: /images/front_top.gif 5: /index.htm 2: /kits.htm 2: /lauristina/packages.htm 19: /leap/team/rob/sceptic.htm 2: /links.htm 3: /links.html 2: /logos/furniture/spacer.gif 2: /logos/national/aus/trinity-green.gif 2: /logos/support/hosts/aus3/aus3_host.gif 2: /logos/support/hosts/components/mirrorbar.gif 3: /lotelaunch/ 48: /mail.gif 2: /mailconf 3: /map.htm 2: /memb.htm 2: /more.htm 89: /msoffice/cltreq.asp 60: /msoffice/cltreq.asp?UL=1&ACT=4&BUILD=2614&STRMVER=4&CAPREQ=0 25: /msoffice/cltreq.asp?UL=1&ACT=4&BUILD=4219&STRMVER=4&CAPREQ=0 3: /newsevnt.html 2: /nhouses/nthcarlton2.html 2: /on this day/otd.htm 2: /onhistory 3: /onhistory/1210.htm 3: /onlncat.htm 2: /onmthisday/.htm 6: /onthisda/1008.htm 6: /onthisday/ 12: /onthisday/00.htm 4: /onthisday/0612.html 3: /onthisday/1008.html 2: /onthisday/1027.html 7: /onthisday/about.html 8: /onthisday/contact.html 6: /onthisday/design_host.html 6: /onthisday/hosted.html 49: /onthisday/images/logo_yarranet_vertical.gif 7: /onthisday/sites.html 12: /onthisday/style_main.css 7: /onthisday/subscriber.html 7: /onthisday/tools.html 6: /onthisday/training.html 4: /organisations/carlib.htm 4: /organisations/cnh.htm 8: /organisations/drc.htm 4: /organisations/library.htm 21: /organisations/nrchc.htm 3: /partners.htm 3: /partners.html 3: /performances.htm 9: /phill/ 2: /phill/fudge/resources/chrsht_bodmndspir_1.0.dot 2: /phill/fudge/resources/chrsht_with_images.doc 2: /phill/fudge/resources/dead_ammo.doc 3: /phill/fudge/resources/dead_chrsht_page1_v4.doc 2: /phill/fudge/resources/dead_chrsht_page2_v4.doc 2: /phill/fudge/resources/dead_screen.doc 3: /phill/fudge/resources/heroes.doc 3: /phill/fudge/resources/rules.doc 2: /phill/fudge/resources/terra_screen_skills.doc 9: /phill/fudge/resources/trav_chrsht_p1_1.5.dot 6: /phill/fudge/resources/trav_chrsht_p2_1.5.dot 8: /phill/fudge/resources/trav_chrsht_single_1.5.dot 2: /phill/fudge/resources/trav_chrsht_skirmish.doc 2: /phill/fudge/resources/trav_screen_players.doc 7: /phill/fudge/resources/trav_screen_skills.doc 3: /phill/fudge/resources/trav_tas11_crew_manifest.doc 3: /phill/fudge/travchar.html 11: /phill/fudge/traveller_char.html 4: /phill/fudge/traveller_char_careers.html 4: /phill/fudge/traveller_char_gifts.html 3: /phill/fudge/traveller_char_races.html 2: /previousstars.htm 3: /programs.html 4: /programsactivities.htm 4: /projects_links.htm 3: /psyc.htm 11: /public/ 2: /pubs.htm 4: /purplesage/bulletin2.html 4: /purplesage/bulletin3.html 3: /purplesage/bulletin32.html 3: /purplesage/speechtranscript.htm 52: /query.gif 3: /r